A unified interface for querying genomic and protein databases via CLI or Python.

Install

mkdir -p .claude/skills/gget && curl -L -o skill.zip "https://agentskills.codes/api/skills/download/1470" && unzip -o skill.zip -d .claude/skills/gget && rm skill.zip

Installs to .claude/skills/gget

Activation

This is the description your AI agent reads to decide when to run this skill — the better it matches your request, the more reliably it fires.

CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices.
310 charsno explicit “when” triggerlonger than Claude Code's old 250-char listing cap (fine on current versions)
Intermediate

Key capabilities

  • →Queries Ensembl and UniProt databases
  • →Retrieves protein structures via AlphaFold
  • →Supports command-line bioinformatics queries
  • →Returns data in JSON or CSV for pipeline integration

How it works

It provides a unified wrapper interface for 20+ specialized bioinformatics APIs and databases.

Inputs & outputs

You give it
Genomic identifiers or query parameters
You get back
Genomic metadata, structure files, or expression data

When to use gget

  • →Querying Ensembl reference genomes
  • →Fetching protein structures from AlphaFold
  • →Retrieving gene expression data
  • →Performing quick BLAST searches

About this skill

gget

Overview

gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.

Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.

Installation

Install gget in a clean virtual environment to avoid conflicts:

# Using uv (recommended)
uv uv pip install gget

# Or using pip
uv pip install --upgrade gget

# In Python/Jupyter
import gget

Quick Start

Basic usage pattern for all modules:

# Command-line
gget <module> [arguments] [options]

# Python
gget.module(arguments, options)

Most modules return:

  • Command-line: JSON (default) or CSV with -csv flag
  • Python: DataFrame or dictionary

Common flags across modules:

  • -o/--out: Save results to file
  • -q/--quiet: Suppress progress information
  • -csv: Return CSV format (command-line only)

Module Categories

1. Reference & Gene Information

gget ref - Reference Genome Downloads

Retrieve download links and metadata for Ensembl reference genomes.

Parameters:

  • species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
  • -w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
  • -r/--release: Ensembl release number (default: latest)
  • -l/--list_species: List available vertebrate species
  • -liv/--list_iv_species: List available invertebrate species
  • -ftp: Return only FTP links
  • -d/--download: Download files (requires curl)

Examples:

# List available species
gget ref --list_species

# Get all reference files for human
gget ref homo_sapiens

# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)

gget search - Gene Search

Locate genes by name or description across species.

Parameters:

  • searchwords: One or more search terms (case-insensitive)
  • -s/--species: Target species (e.g., 'homo_sapiens', 'mouse')
  • -r/--release: Ensembl release number
  • -t/--id_type: Return 'gene' (default) or 'transcript'
  • -ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL
  • -l/--limit: Maximum results to return

Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL

Examples:

# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric

# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")

gget info - Gene/Transcript Information

Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.

Parameters:

  • ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
  • -n/--ncbi: Disable NCBI data retrieval
  • -u/--uniprot: Disable UniProt data retrieval
  • -pdb: Include PDB identifiers (increases runtime)

Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript

Examples:

# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296

# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)

gget seq - Sequence Retrieval

Fetch nucleotide or amino acid sequences for genes and transcripts.

Parameters:

  • ens_ids: One or more Ensembl identifiers
  • -t/--translate: Fetch amino acid sequences instead of nucleotide
  • -iso/--isoforms: Return all transcript variants (gene IDs only)

Returns: FASTA format sequences

Examples:

# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853

# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)

2. Sequence Analysis & Alignment

gget blast - BLAST Searches

BLAST nucleotide or amino acid sequences against standard databases.

Parameters:

  • sequence: Sequence string or path to FASTA/.txt file
  • -p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
  • -db/--database:
    • Nucleotide: nt, refseq_rna, pdbnt
    • Protein: nr, swissprot, pdbaa, refseq_protein
  • -l/--limit: Max hits (default: 50)
  • -e/--expect: E-value cutoff (default: 10.0)
  • -lcf/--low_comp_filt: Enable low complexity filtering
  • -mbo/--megablast_off: Disable MegaBLAST (blastn only)

Examples:

# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)

gget blat - BLAT Searches

Locate genomic positions of sequences using UCSC BLAT.

Parameters:

  • sequence: Sequence string or path to FASTA/.txt file
  • -st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
  • -a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)

Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage

Examples:

# Find genomic location in human
gget blat ATCGATCGATCGATCG

# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")

gget muscle - Multiple Sequence Alignment

Align multiple nucleotide or amino acid sequences using Muscle5.

Parameters:

  • fasta: Sequences or path to FASTA/.txt file
  • -s5/--super5: Use Super5 algorithm for faster processing (large datasets)

Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)

Examples:

# Align sequences from file
gget muscle sequences.fasta -o aligned.afa

# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)

gget diamond - Local Sequence Alignment

Perform fast local protein or translated DNA alignment using DIAMOND.

Parameters:

  • Query: Sequences (string/list) or FASTA file path
  • --reference: Reference sequences (string/list) or FASTA file path (required)
  • --sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
  • --threads: CPU threads (default: 1)
  • --diamond_db: Save database for reuse
  • --translated: Enable nucleotide-to-amino acid alignment

Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores

Examples:

# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4

# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)

3. Structural & Protein Analysis

gget pdb - Protein Structures

Query RCSB Protein Data Bank for structure and metadata.

Parameters:

  • pdb_id: PDB identifier (e.g., '7S7U')
  • -r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)
  • -i/--identifier: Assembly, entity, or chain ID

Returns: PDB format (structures) or JSON (metadata)

Examples:

# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb

# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)

gget alphafold - Protein Structure Prediction

Predict 3D protein structures using simplified AlphaFold2.

Setup Required:

# Install OpenMM first
uv pip install openmm

# Then setup AlphaFold
gget setup alphafold

Parameters:

  • sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
  • -mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)
  • -mfm/--multimer_for_monomer: Apply multimer model to single proteins
  • -r/--relax: AMBER relaxation for top-ranked model
  • plot: Python-only; generate interactive 3D visualization (default: True)
  • show_sidechains: Python-only; include side chains (default: True)

Returns: PDB structure file, JSON alignment error data, optional 3D visualization

Examples:

# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR

# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)

# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)

gget elm - Eukaryotic Linear Motifs

Predict Eukaryotic Linear Motifs in protein sequences.

Setup Required:

gget setup elm

Parameters:

  • sequence: Amino acid sequence or UniProt Acc
  • -u/--uniprot: Indicates sequence is UniProt Acc
  • -e/--expand: Include protein names, organisms, references
  • -s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")
  • -t/--threads: Number of threads (default: 1)

Returns: Two outputs:

  1. ortholog_df: Linear motifs from orthologous proteins
  2. regex_df: Motifs directly matched in input sequence

Examples:

# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results

# Use UniProt accession wi

---

*Content truncated.*

When not to use it

  • →For heavy, non-bioinformatics data processing
  • →When massive local BLAST databases are required (use local binaries)

Prerequisites

Python environmentGget installation

Limitations

  • →Dependent on uptime/structure of third-party bio databases
  • →Not intended for complex bioinformatics algorithm development

How it compares

It centralizes access to disparate biological data sources into a single toolset, replacing multiple manual API scripts.

Compared to similar skills

gget side by side with the closest alternatives in the catalog.

SkillInstallsUpdatedSafetyDifficulty
gget (this skill)39moReviewIntermediate
literature-review5593moReviewAdvanced
openalex-database489moReviewIntermediate
scientific-critical-thinking189moReviewAdvanced

Try saying

Example prompts that trigger this skill in your AI assistant.

software-architecture

davila7

Guide for quality focused software architecture. This skill should be used when users want to write code, design architecture, analyze code, in any case that relates to software development.

333868

planning-with-files

davila7

Implements Manus-style file-based planning for complex tasks. Creates task_plan.md, findings.md, and progress.md. Use when starting complex multi-step tasks, research projects, or any task requiring >5 tool calls.

233106

telegram-bot-builder

davila7

Expert in building Telegram bots that solve real problems - from simple automation to complex AI-powered bots. Covers bot architecture, the Telegram Bot API, user experience, monetization strategies, and scaling bots to thousands of users. Use when: telegram bot, bot api, telegram automation, chat bot telegram, tg bot.

106130

scroll-experience

davila7

Expert in building immersive scroll-driven experiences - parallax storytelling, scroll animations, interactive narratives, and cinematic web experiences. Like NY Times interactives, Apple product pages, and award-winning web experiences. Makes websites feel like experiences, not just pages. Use when: scroll animation, parallax, scroll storytelling, interactive story, cinematic website.

101142

humanizer

davila7

Remove signs of AI-generated writing from text. Use when editing or reviewing text to make it sound more natural and human-written. Based on Wikipedia's comprehensive "Signs of AI writing" guide. Detects and fixes patterns including: inflated symbolism, promotional language, superficial -ing analyses, vague attributions, em dash overuse, rule of three, AI vocabulary words, negative parallelisms, and excessive conjunctive phrases. Credits: Original skill by @blader - https://github.com/blader/humanizer

90175

game-development

davila7

Game development orchestrator. Routes to platform-specific skills based on project needs.

70195

You might also like

literature-review

K-Dense-AI

Conduct comprehensive, systematic literature reviews using multiple academic databases (PubMed, arXiv, bioRxiv, Semantic Scholar, etc.). This skill should be used when conducting systematic literature reviews, meta-analyses, research synthesis, or comprehensive literature searches across biomedical, scientific, and technical domains. Creates professionally formatted markdown documents and PDFs with verified citations in multiple citation styles (APA, Nature, Vancouver, etc.).

5591,298

openalex-database

davila7

Query and analyze scholarly literature using the OpenAlex database. This skill should be used when searching for academic papers, analyzing research trends, finding works by authors or institutions, tracking citations, discovering open access publications, or conducting bibliometric analysis across 240M+ scholarly works. Use for literature searches, research output analysis, citation analysis, and academic database queries.

48202

scientific-critical-thinking

davila7

Evaluate research rigor. Assess methodology, experimental design, statistical validity, biases, confounding, evidence quality (GRADE, Cochrane ROB), for critical analysis of scientific claims.

1888

biorxiv-database

lifangda

Efficient database search tool for bioRxiv preprint server. Use this skill when searching for life sciences preprints by keywords, authors, date ranges, or categories, retrieving paper metadata, downloading PDFs, or conducting literature reviews.

780

physics-validator

omriwen

Validate optical physics parameters including Fresnel numbers, diffraction regimes, and resolution limits. This skill should be used when configuring Telescope, Microscope, or Camera instruments to ensure physically realistic parameters.

664

fda-database

davila7

Query openFDA API for drugs, devices, adverse events, recalls, regulatory submissions (510k, PMA), substance identification (UNII), for FDA regulatory data analysis and safety research.

539

Search skills

Search the agent skills registry