A unified interface for querying genomic and protein databases via CLI or Python.
Install
mkdir -p .claude/skills/gget && curl -L -o skill.zip "https://agentskills.codes/api/skills/download/1470" && unzip -o skill.zip -d .claude/skills/gget && rm skill.zipInstalls to .claude/skills/gget
Activation
This is the description your AI agent reads to decide when to run this skill — the better it matches your request, the more reliably it fires.
CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices.Key capabilities
- →Queries Ensembl and UniProt databases
- →Retrieves protein structures via AlphaFold
- →Supports command-line bioinformatics queries
- →Returns data in JSON or CSV for pipeline integration
How it works
It provides a unified wrapper interface for 20+ specialized bioinformatics APIs and databases.
Inputs & outputs
When to use gget
- →Querying Ensembl reference genomes
- →Fetching protein structures from AlphaFold
- →Retrieving gene expression data
- →Performing quick BLAST searches
About this skill
gget
Overview
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
Installation
Install gget in a clean virtual environment to avoid conflicts:
# Using uv (recommended)
uv uv pip install gget
# Or using pip
uv pip install --upgrade gget
# In Python/Jupyter
import gget
Quick Start
Basic usage pattern for all modules:
# Command-line
gget <module> [arguments] [options]
# Python
gget.module(arguments, options)
Most modules return:
- Command-line: JSON (default) or CSV with
-csvflag - Python: DataFrame or dictionary
Common flags across modules:
-o/--out: Save results to file-q/--quiet: Suppress progress information-csv: Return CSV format (command-line only)
Module Categories
1. Reference & Gene Information
gget ref - Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
Parameters:
species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'-w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all-r/--release: Ensembl release number (default: latest)-l/--list_species: List available vertebrate species-liv/--list_iv_species: List available invertebrate species-ftp: Return only FTP links-d/--download: Download files (requires curl)
Examples:
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
gget search - Gene Search
Locate genes by name or description across species.
Parameters:
searchwords: One or more search terms (case-insensitive)-s/--species: Target species (e.g., 'homo_sapiens', 'mouse')-r/--release: Ensembl release number-t/--id_type: Return 'gene' (default) or 'transcript'-ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL-l/--limit: Maximum results to return
Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
Examples:
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
gget info - Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
Parameters:
ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs-n/--ncbi: Disable NCBI data retrieval-u/--uniprot: Disable UniProt data retrieval-pdb: Include PDB identifiers (increases runtime)
Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
Examples:
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
gget seq - Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
Parameters:
ens_ids: One or more Ensembl identifiers-t/--translate: Fetch amino acid sequences instead of nucleotide-iso/--isoforms: Return all transcript variants (gene IDs only)
Returns: FASTA format sequences
Examples:
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
2. Sequence Analysis & Alignment
gget blast - BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)-db/--database:- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
-l/--limit: Max hits (default: 50)-e/--expect: E-value cutoff (default: 10.0)-lcf/--low_comp_filt: Enable low complexity filtering-mbo/--megablast_off: Disable MegaBLAST (blastn only)
Examples:
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
gget blat - BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)-a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)
Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage
Examples:
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
gget muscle - Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
Parameters:
fasta: Sequences or path to FASTA/.txt file-s5/--super5: Use Super5 algorithm for faster processing (large datasets)
Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)
Examples:
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)
gget diamond - Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
Parameters:
- Query: Sequences (string/list) or FASTA file path
--reference: Reference sequences (string/list) or FASTA file path (required)--sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive--threads: CPU threads (default: 1)--diamond_db: Save database for reuse--translated: Enable nucleotide-to-amino acid alignment
Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
Examples:
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
3. Structural & Protein Analysis
gget pdb - Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
Parameters:
pdb_id: PDB identifier (e.g., '7S7U')-r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)-i/--identifier: Assembly, entity, or chain ID
Returns: PDB format (structures) or JSON (metadata)
Examples:
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)
gget alphafold - Protein Structure Prediction
Predict 3D protein structures using simplified AlphaFold2.
Setup Required:
# Install OpenMM first
uv pip install openmm
# Then setup AlphaFold
gget setup alphafold
Parameters:
sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling-mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)-mfm/--multimer_for_monomer: Apply multimer model to single proteins-r/--relax: AMBER relaxation for top-ranked modelplot: Python-only; generate interactive 3D visualization (default: True)show_sidechains: Python-only; include side chains (default: True)
Returns: PDB structure file, JSON alignment error data, optional 3D visualization
Examples:
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
gget elm - Eukaryotic Linear Motifs
Predict Eukaryotic Linear Motifs in protein sequences.
Setup Required:
gget setup elm
Parameters:
sequence: Amino acid sequence or UniProt Acc-u/--uniprot: Indicates sequence is UniProt Acc-e/--expand: Include protein names, organisms, references-s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")-t/--threads: Number of threads (default: 1)
Returns: Two outputs:
- ortholog_df: Linear motifs from orthologous proteins
- regex_df: Motifs directly matched in input sequence
Examples:
# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results
# Use UniProt accession wi
---
*Content truncated.*
When not to use it
- →For heavy, non-bioinformatics data processing
- →When massive local BLAST databases are required (use local binaries)
Prerequisites
Limitations
- →Dependent on uptime/structure of third-party bio databases
- →Not intended for complex bioinformatics algorithm development
How it compares
It centralizes access to disparate biological data sources into a single toolset, replacing multiple manual API scripts.
Compared to similar skills
gget side by side with the closest alternatives in the catalog.
| Skill | Installs | Updated | Safety | Difficulty |
|---|---|---|---|---|
| gget (this skill) | 3 | 9mo | Review | Intermediate |
| literature-review | 559 | 3mo | Review | Advanced |
| openalex-database | 48 | 9mo | Review | Intermediate |
| scientific-critical-thinking | 18 | 9mo | Review | Advanced |
Try saying
Example prompts that trigger this skill in your AI assistant.
More by davila7
View all by davila7 →You might also like
literature-review
K-Dense-AI
Conduct comprehensive, systematic literature reviews using multiple academic databases (PubMed, arXiv, bioRxiv, Semantic Scholar, etc.). This skill should be used when conducting systematic literature reviews, meta-analyses, research synthesis, or comprehensive literature searches across biomedical, scientific, and technical domains. Creates professionally formatted markdown documents and PDFs with verified citations in multiple citation styles (APA, Nature, Vancouver, etc.).
openalex-database
davila7
Query and analyze scholarly literature using the OpenAlex database. This skill should be used when searching for academic papers, analyzing research trends, finding works by authors or institutions, tracking citations, discovering open access publications, or conducting bibliometric analysis across 240M+ scholarly works. Use for literature searches, research output analysis, citation analysis, and academic database queries.
scientific-critical-thinking
davila7
Evaluate research rigor. Assess methodology, experimental design, statistical validity, biases, confounding, evidence quality (GRADE, Cochrane ROB), for critical analysis of scientific claims.
biorxiv-database
lifangda
Efficient database search tool for bioRxiv preprint server. Use this skill when searching for life sciences preprints by keywords, authors, date ranges, or categories, retrieving paper metadata, downloading PDFs, or conducting literature reviews.
physics-validator
omriwen
Validate optical physics parameters including Fresnel numbers, diffraction regimes, and resolution limits. This skill should be used when configuring Telescope, Microscope, or Camera instruments to ensure physically realistic parameters.
fda-database
davila7
Query openFDA API for drugs, devices, adverse events, recalls, regulatory submissions (510k, PMA), substance identification (UNII), for FDA regulatory data analysis and safety research.